LRRC75B Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C22orf36

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: WKSSDKICRQLIYHLTPHSKQQQGSSLRQRKTQSCLKSSLQKTLLAGETV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: leucine-rich repeat-containing protein 75B

Protein Size: 315

Purification: Affinity Purified

• SKU: AVIARP56011_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56011_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 388886
• Host: Rabbit