LSM14A Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LSM14A

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: KLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein LSM14 homolog A

Protein Size: 463

Purification: Affinity Purified

• SKU: AVIARP55289_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55289_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 26065
• Host: Rabbit