LUC7L Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The LUC7L gene may represent a mammalian heterochromatic gene, encoding a putative RNA-binding protein similar to the yeast Luc7p subunit of the U1 snRNP splicing complex that is normally required for 5-prime splice site selection (Tufarelli et al., 2001 [PubMed 11170747]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LUC7L

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: EEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPAS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LUC7-like (S. cerevisiae) EMBL CAM26672.1

Protein Size: 325

Purification: Affinity Purified

• SKU: AVIARP57816_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57816_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55692
• Host: Rabbit