Lyar Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: INELIKKPNVSPKVRELLQQISAFDNVPRKKAKFQNWMKNSLKVHSDSVL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cell growth-regulating nucleolar protein

Protein Size: 388

Purification: Affinity Purified

• SKU: AVIARP57041_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57041_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 17089
• Host: Rabbit