LYPLA2 Antibody - N-terminal region : HRP

LYPLA2 Antibody - N-terminal region : HRP
SKU
AVIARP58638_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LYPLA2

Key Reference: Ma,J., (2007) Atherosclerosis 191 (1), 63-72

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Acyl-protein thioesterase 2

Protein Size: 231

Purification: Affinity Purified
More Information
SKU AVIARP58638_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58638_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 11313
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×