LYRM1 Antibody - middle region : HRP

LYRM1 Antibody - middle region : HRP
SKU
AVIARP57413_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: LYRM1 may promote cell proliferation and inhibition of apoptosis of preadipocytes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LYRM1

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: LYR motif-containing protein 1

Protein Size: 122

Purification: Affinity Purified
More Information
SKU AVIARP57413_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57413_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57149
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×