MAFB Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: MAFB is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells. The protein encoded by this gene is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The encoded nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells. This gene contains no introns. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MAFB

Key Reference: Gemelli,C., (2006) Cell Death Differ. 13 (10), 1686-1696

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: LIQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transcription factor MafB

Protein Size: 323

Purification: Affinity Purified

• SKU: AVIARP58149_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58149_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 9935
• Host: Rabbit