MAPK12 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal t

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAPK12

Key Reference: Qi,X., (2007) J. Biol. Chem. 282 (43), 31398-31408

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitogen-activated protein kinase 12

Protein Size: 367

Purification: Affinity Purified

• SKU: AVIARP56535_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56535_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 6300
• Host: Rabbit