MEAK7 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA1609

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: MGNSRSRVGRSFCSQFLPEEQAEIDQLFDALSSDKNSPNVSSKSFSLKAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TLD domain-containing protein 1

Protein Size: 456

Purification: Affinity Purified

• SKU: AVIARP57503_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57503_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57707
• Host: Rabbit