MED16 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: THRAP5 is part of the human thyroid hormone receptor-associated protein (TRAP)-Mediator family which acts as a coactivator for a broad range of nuclear hormone receptors as well as other classes of transcriptional activators.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MED16

Key Reference: Sato,S., (2004) Mol. Cell 14 (5), 685-691

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: MSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPAS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mediator of RNA polymerase II transcription subunit 16

Protein Size: 877

Purification: Affinity Purified

Subunit: 16

• SKU: AVIARP57927_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57927_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10025
• Host: Rabbit