MED7 Antibody - middle region : Biotin

MED7 Antibody - middle region : Biotin
SKU
AVIARP57925_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MED7

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: KRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDAD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mediator of RNA polymerase II transcription subunit 7

Protein Size: 233

Purification: Affinity Purified

Subunit: 7
More Information
SKU AVIARP57925_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57925_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Chromatin Immunoprecipitation (ChIP)
Human Gene ID 9443
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×