METAP1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: METAP1 removes the amino-terminal methionine from nascent proteins. METAP1 is required for normal progression through the cell cycle.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human METAP1

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Methionine aminopeptidase 1

Protein Size: 386

Purification: Affinity Purified

• SKU: AVIARP55179_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55179_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23173
• Host: Rabbit