MGC51025 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: MGC51025 may act as a GTPase-activating protein for Rab family protein(s).

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MGC51025

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: LLCLPEEDAFWALTQLLAGERHSLWYSTAQILPGSRGSYRTRSRCCTSPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TBC1 domain family member 26

Protein Size: 250

Purification: Affinity Purified

• SKU: AVIARP55784_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55784_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 353149
• Host: Rabbit