MINDY1 Antibody - middle region : Biotin

MINDY1 Antibody - middle region : Biotin
SKU
AVIARP56272_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM63A

Key Reference: Lehner,B. (2004) Genome Res. 14 (7), 1315-1323

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: LQQEEYQQQQAAQPVRMRTRVLSLQGRGATSGRPAGERRQRPKHESDCIL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ubiquitin carboxyl-terminal hydrolase MINDY-1

Protein Size: 327

Purification: Affinity Purified
More Information
SKU AVIARP56272_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56272_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55793
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×