MNS1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein highly similar to the mouse meiosis-specific nuclear structural 1 protein. The mouse protein was shown to be expressed at the pachytene stage during spermatogenesis and may function as a nuclear skeletal protein to regulate nuc

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MNS1

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: KVQENEEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Meiosis-specific nuclear structural protein 1

Protein Size: 495

Purification: Affinity Purified

• SKU: AVIARP57224_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57224_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55329
• Host: Rabbit