MPP2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Palmitoylated membrane protein 2 is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracel

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MPP2

Key Reference: Wierstra,I. (2006) Biol. Chem. 387 (7), 963-976

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: QGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEME

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: MAGUK p55 subfamily member 2

Protein Size: 552

Purification: Affinity Purified

• SKU: AVIARP56632_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56632_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4355
• Host: Rabbit