MRPS2 Antibody - N-terminal region : Biotin

MRPS2 Antibody - N-terminal region : Biotin
SKU
AVIARP56812_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MRPS2

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 28S ribosomal protein S2, mitochondrial

Protein Size: 296

Purification: Affinity Purified
More Information
SKU AVIARP56812_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56812_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51116
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×