MS4A4A Antibody - N-terminal region : HRP

MS4A4A Antibody - N-terminal region : HRP
SKU
AVIARP58497_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: MS4A4A is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues.This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. Alternative splicing of this gene results in several transcript variants; however, not all transcripts have been fully described.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MS4A4A

Key Reference: Liang,Y., (2001) Immunogenetics 53 (5), 357-368

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Membrane-spanning 4-domains subfamily A member 4A

Protein Size: 239

Purification: Affinity Purified
More Information
SKU AVIARP58497_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58497_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51338
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×