MTMR12 Antibody - middle region : Biotin

MTMR12 Antibody - middle region : Biotin
SKU
AVIARP56273_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: MTMR12 inactives phosphatase that plays a role as an adapter for the phosphatase myotubularin to regulate myotubularin intracellular location.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MTMR12

Key Reference: Nandurkar,H.H., (2003) Proc. Natl. Acad. Sci. U.S.A. 100 (15), 8660-8665

Molecular Weight: 86kDa

Peptide Sequence: Synthetic peptide located within the following region: PLYVEKPKLDKGQRKGMRFKHQRQLSLPLTQSKSSPKRGFFREETDHLIK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Myotubularin-related protein 12

Protein Size: 747

Purification: Affinity Purified
More Information
SKU AVIARP56273_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56273_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54545
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×