MVP Antibody - N-terminal region : Biotin

MVP Antibody - N-terminal region : Biotin
SKU
AVIARP58642_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: MVP is required for normal vault structure. Vaults are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction. Vaults may also play a role in nucleo-cytoplasmic transport. MVP down-regulates INFG-mediated STAT1 signaling and subsequent activation of JAK. MVP down-regulates SRC activity and signaling through MAP kinases.This gene encodes the major vault protein which is a lung resistance-related protein. Vaults are multi-subunit structures that may be involved in nucleo-cytoplasmic transport. This protein mediates drug resistance, perhaps via a transport process. It is widely distributed in normal tissues, and overexpressed in multidrug-resistant cancer cells. The protein overexpression is a potentially useful marker of clinical drug resistance. This gene produces two transcripts by using two alternative exon 2 sequences; however, the open reading frames are the same in both transcripts.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MVP

Key Reference: de (2008) Cytometry B Clin Cytom 74 (3), 163-168

Molecular Weight: 98kDa

Peptide Sequence: Synthetic peptide located within the following region: MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Major vault protein

Protein Size: 893

Purification: Affinity Purified
More Information
SKU AVIARP58642_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58642_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 9961
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×