MYL6 Antibody - middle region : HRP

MYL6 Antibody - middle region : HRP
SKU
AVIARP57712_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: MYL6 contains 3 EF-hand domains. It is the regulatory light chain of myosin. MYL6 does not bind calcium. Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MYL6

Key Reference: Fu,Z.Y., (2006) Acta Biochim. Biophys. Sin. (Shanghai) 38 (9), 625-632

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: PMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Myosin light polypeptide 6

Protein Size: 151

Purification: Affinity Purified
More Information
SKU AVIARP57712_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57712_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 4637
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×