MYO1C Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a member of the unconventional myosin protein family, which are actin-based molecular motors. The protein is found in the cytoplasm, and one isoform with a unique N-terminus is also found in the nucleus. The nuclear isoform associates wi

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYO1C

Key Reference: Kahle,M., (2007) Histochem. Cell Biol. 127 (2), 139-148

Molecular Weight: 118kDa

Peptide Sequence: Synthetic peptide located within the following region: NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Unconventional myosin-Ic

Protein Size: 1028

Purification: Affinity Purified

Specificity#: isoform 1, 2 and 3

• SKU: AVIARP56292_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56292_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4641
• Host: Rabbit