NCDN Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a leucine-rich cytoplasmic protein, which is highly similar to a mouse protein that negatively regulates Ca/calmodulin-dependent protein kinase II phosphorylation and may be essential for spatial learning processes. Several alternatively

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NCDN

Key Reference: Qiu,C., (2008) J. Biol. Chem. 283 (5), 2734-2740

Molecular Weight: 79kDa

Peptide Sequence: Synthetic peptide located within the following region: MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Neurochondrin

Protein Size: 729

Purification: Affinity Purified

• SKU: AVIARP54995_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54995_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23154
• Host: Rabbit