Ndufv2 Antibody - N-terminal region : FITC

Ndufv2 Antibody - N-terminal region : FITC
SKU
AVIARP57509_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Ndufv2

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: GAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHQAAAVLPV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

Protein Size: 248

Purification: Affinity Purified
More Information
SKU AVIARP57509_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57509_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 72900
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×