NECAB1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NECA1

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: DSQETSPSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: N-terminal EF-hand calcium-binding protein 1

Protein Size: 351

Purification: Affinity Purified

• SKU: AVIARP57627_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57627_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 64168
• Host: Rabbit