NIT1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: NIT1 play a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. NIT1 has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells; this effect is additive to the tum

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NIT1

Key Reference: Semba,S., (2006) J. Biol. Chem. 281 (38), 28244-28253

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nitrilase homolog 1

Protein Size: 327

Purification: Affinity Purified

• SKU: AVIARP56646_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56646_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4817
• Host: Rabbit