NLRP5 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene belongs to the NALP protein family. Members of the NALP protein family typically contain a NACHT domain, a NACHT-associated domain (NAD), a C-terminal leucine-rich repeat (LRR) region, and an N-terminal pyrin domain (PYD). Expression of this gene is restricted to the oocyte. A mouse gene that encodes a maternal oocyte protein, similar to this encoded protein, is required for normal early embryogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NLRP5

Molecular Weight: 134kDa

Peptide Sequence: Synthetic peptide located within the following region: LAWATSISIFENMNLRTLSEKARDDMKRHSPEDPEATMTDQGPSKEKVPG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NACHT, LRR and PYD domains-containing protein 5

Protein Size: 1200

Purification: Affinity Purified

• SKU: AVIARP59021_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59021_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 126206
• Host: Rabbit