NOMO1 Antibody - N-terminal region : FITC

NOMO1 Antibody - N-terminal region : FITC
SKU
AVIARP54997_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NOMO1 was originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE). This gene encodes a protein originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NOMO1

Key Reference: Lim,J., (2006) Cell 125 (4), 801-814

Molecular Weight: 134kDa

Peptide Sequence: Synthetic peptide located within the following region: DGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nodal modulator 3

Protein Size: 1222

Purification: Affinity Purified
More Information
SKU AVIARP54997_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54997_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23420
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×