NOSIP Antibody - N-terminal region : Biotin

NOSIP Antibody - N-terminal region : Biotin
SKU
AVIARP56784_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: NOSIP negatively regulates nitric oxide production by inducing NOS1 and NOS3 translocation to actin cytoskeleton and inhibiting their enzymatic activity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NOSIP

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: LSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nitric oxide synthase-interacting protein

Protein Size: 301

Purification: Affinity Purified
More Information
SKU AVIARP56784_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56784_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51070
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×