NPM2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: NPM2 is a core histones chaperone involved in chromatin reprogramming, specially during fertilization and early embryonic development. It probably involved in sperm DNA decondensation during fertilization.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NPM2

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRLLLHTIC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nucleoplasmin-2

Protein Size: 214

Purification: Affinity Purified

• SKU: AVIARP58310_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58310_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10361
• Host: Rabbit