NPM2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: NPM2 belongs to the nucleoplasmin family. It probably involved in sperm DNA decondensation during fertilization.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NPM2

Key Reference: Burns,K.H., (2003) Science 300 (5619), 633-636

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Nucleoplasmin-2

Protein Size: 214

Purification: Affinity Purified

• SKU: AVIARP58311_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58311_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10361
• Host: Rabbit