NT5M Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NT5M

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 5'(3')-deoxyribonucleotidase, mitochondrial

Protein Size: 228

Purification: Affinity Purified

• SKU: AVIARP57370_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57370_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 56953
• Host: Rabbit