OBP2A Antibody - middle region : FITC

OBP2A Antibody - middle region : FITC
SKU
AVIARP55085_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a small extracellular protein belonging to the lipocalin superfamily. The protein is thought to transport small, hydrophobic, volatile molecules or odorants through the nasal mucus to olfactory receptors, and may also function as a scavenger of highly concentrated or toxic odors. The protein is expressed as a monomer in the nasal mucus, and can bind diverse types of odorants with a higher affinity for aldehydes and fatty acids. This gene and a highly similar family member are located in a cluster of lipocalin genes on chromosome 9. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: NLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Odorant-binding protein 2a

Protein Size: 170

Purification: Affinity Purified
More Information
SKU AVIARP55085_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55085_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29991
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×