OGDHL Antibody - N-terminal region : Biotin

OGDHL Antibody - N-terminal region : Biotin
SKU
AVIARP57175_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of OGDHL remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OGDHL

Molecular Weight: 114kDa

Peptide Sequence: Synthetic peptide located within the following region: VFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSWDSFFR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 2-oxoglutarate dehydrogenase-like, mitochondrial

Protein Size: 1010

Purification: Affinity Purified
More Information
SKU AVIARP57175_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57175_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55753
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×