OLAH Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: OLAH plays a role in fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex. The chain length of the released f

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OLAH

Key Reference: Nakamura,N., (2006) DNA Res. 13 (4), 169-183

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: S-acyl fatty acid synthase thioesterase, medium chain

Protein Size: 265

Purification: Affinity Purified

• SKU: AVIARP56263_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56263_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Pig (Porcine), Rabbit, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55301
• Host: Rabbit