OMD Antibody - middle region : FITC

OMD Antibody - middle region : FITC
SKU
AVIARP56612_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: OMD may be implicated in biomineralization processes. Has a function in binding of osteoblasts via the alpha(V)beta(3)-integrin.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OMD

Key Reference: Couble,M.L., (2004) Histochem. Cell Biol. 121 (1), 47-53

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: LLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Osteomodulin

Protein Size: 421

Purification: Affinity Purified

Subunit: 5
More Information
SKU AVIARP56612_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56612_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56612
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×