ORC4L Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ORC4L

Key Reference: Clarke,C.A. Biochem. J. 388 (PT 2), 705-712 (2005)

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Origin recognition complex subunit 4

Protein Size: 436

Purification: Affinity Purified

Subunit: 4

• SKU: AVIARP57782_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57782_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5000
• Host: Rabbit