OTUD6B Antibody - middle region : Biotin

OTUD6B Antibody - middle region : Biotin
SKU
AVIARP56809_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Deubiquitinating enzymes (DUBs; see MIM 603478) are proteases that specifically cleave ubiquitin (MIM 191339) linkages, negating the action of ubiquitin ligases. DUBA5 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OTUD6B

Key Reference: Worby,C.A. (2002) Nat. Rev. Mol. Cell Biol. 3 (12), 919-931

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: OTU domain-containing protein 6B

Protein Size: 323

Purification: Affinity Purified
More Information
SKU AVIARP56809_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56809_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51633
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×