PADI4 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: PADI4 is an enzyme responsible for the conversion of arginine residues to citrulline residues. This protein may play a role in granulocyte and macrophage development leading to inflammation and immune response.This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PADI4

Key Reference: Costenbader,K.H., (er) Arthritis Res. Ther. 10 (3), R52 (2008) In press

Molecular Weight: 74kDa

Peptide Sequence: Synthetic peptide located within the following region: TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein-arginine deiminase type-4

Protein Size: 663

Purification: Affinity Purified

• SKU: AVIARP54888_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54888_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23569
• Host: Rabbit