PAFAH1B2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Platelet-activating factor acetylhydrolase (PAFAH) inactivates platelet-activating factor (PAF) into acetate and LYSO-PAF. This gene encodes the beta subunit of PAFAH, the other subunits are alpha and gamma. Multiple alternatively spliced transcript varia

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PAFAH1B2

Key Reference: Scott,B.T., Prostaglandins Other Lipid Mediat. 85 (3-4), 69-80 (2008)

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Platelet-activating factor acetylhydrolase IB subunit beta

Protein Size: 229

Purification: Affinity Purified

Subunit: beta

• SKU: AVIARP58507_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58507_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5049
• Host: Rabbit