PELI1 Antibody - N-terminal region : FITC

PELI1 Antibody - N-terminal region : FITC
SKU
AVIARP57429_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PELI1 is an scaffold protein involved in the IL-1 signaling pathway via its interaction with the complex containing IRAK kinases and TRAF6. PELI1 is required for NF-kappa-B activation and IL-8 gene expression in response to IL-1.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PELI1

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: E3 ubiquitin-protein ligase pellino homolog 1

Protein Size: 418

Purification: Affinity Purified
More Information
SKU AVIARP57429_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57429_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57162
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×