PENK Antibody - middle region : FITC

PENK Antibody - middle region : FITC
SKU
AVIARP56676_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress. PENK (114-133) and PENK (237-258) increase glutamate release in the stri

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PENK

Key Reference: Nikoshkov,A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (2), 786-791

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proenkephalin-A

Protein Size: 267

Purification: Affinity Purified
More Information
SKU AVIARP56676_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56676_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5179
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×