PES1 Antibody - C-terminal region : Biotin

PES1 Antibody - C-terminal region : Biotin
SKU
AVIARP55008_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PES1 is abnormally elevated in malignant tumors of astrocytic origin. It is a strongly conserved gene containing a BRCT domain that is essential for the activity of this gene product. The gene plays a crucial role in cell proliferation and may be necessary for oncogenic transformation and tumor progression.This gene encodes a protein that is abnormally elevated in malignant tumors of astrocytic origin. It is a strongly conserved gene containing a BRCT domain that is essential for the activity of this gene product. The gene plays a crucial role in cell proliferation and may be necessary for oncogenic transformation and tumor progression. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PES1

Key Reference: Rohrmoser,M., (2007) Mol. Cell. Biol. 27 (10), 3682-3694

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: KKREKYLYQKIMFGKRRKIREANKLAEKRKAHDEAVRSEKKAKKARPE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pescadillo homolog

Protein Size: 588

Purification: Affinity Purified
More Information
SKU AVIARP55008_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55008_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23481
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×