Pfkfb2 Antibody - C-terminal region : Biotin

Pfkfb2 Antibody - C-terminal region : Biotin
SKU
AVIARP56678_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: RNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRALDMQEGADQPKTQVSI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 6-phosphofructo-2-kinase Ensembl ENSMUSP00000133073 Ensembl ENSMUSP00000066426

Protein Size: 518

Purification: Affinity Purified
More Information
SKU AVIARP56678_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56678_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 18640
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×