PGM1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: PGM1 is an isozyme of phosphoglucomutase (PGM) and belongs to the phosphohexose mutase family. There are several PGM isozymes, which are encoded by different genes and catalyze the transfer of phosphate between the 1 and 6 positions of glucose. In most cell types, this PGM isozyme is predominant, representing about 90% of total PGM activity. In red cells, PGM2 is a major isozyme. This gene is highly polymorphic. Mutations in this gene cause glycogen storage disease type 14.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PGM1

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: TVEKADNFEYSDPVDGSISRNQGLRLIFTDGSRIVFRLSGTGSAGATIRL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphoglucomutase-1

Protein Size: 562

Purification: Affinity Purified

• SKU: AVIARP56383_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56383_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5236
• Host: Rabbit