PHLDA3 Antibody - N-terminal region : Biotin

PHLDA3 Antibody - N-terminal region : Biotin
SKU
AVIARP54891_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The exact function of PHLDA3 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PHLDA3

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: LQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pleckstrin homology-like domain family A member 3

Protein Size: 127

Purification: Affinity Purified
More Information
SKU AVIARP54891_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54891_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23612
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×