PI4KB Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Phosphorylates phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol-1,4,5,-trisphosphate (PIP). PI4KB may regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation. Involved in Golgi-to-plasma membrane trafficking.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PI4KB

Molecular Weight: 93kDa

Peptide Sequence: Synthetic peptide located within the following region: HMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphatidylinositol 4-kinase beta

Protein Size: 828

Purification: Affinity Purified

• SKU: AVIARP56394_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56394_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 5298
• Host: Rabbit