PIK3R5 Antibody - middle region : Biotin

PIK3R5 Antibody - middle region : Biotin
SKU
AVIARP55012_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Receptor-regulated class I phosphoinositide 3-kinases (PI3Ks) phosphorylate the membrane lipid phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) to PtdIns(3,4,5)P3, which in turn recruits and activates cytosolic effectors involved in proliferation, survival, or chemotaxis. PIK3R5 is a PI3K regulatory subunit.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PIK3R5

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: SRAQRSRSLPQPKLGTQLPSWLLAPASRPQRRRPFLSGDEDPKASTLRVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphoinositide 3-kinase regulatory subunit 5

Protein Size: 880

Purification: Affinity Purified

Subunit: 5
More Information
SKU AVIARP55012_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55012_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23533
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×