PINX1 Antibody - N-terminal region : Biotin

PINX1 Antibody - N-terminal region : Biotin
SKU
AVIARP57057_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PINX1 is a microtubule-binding protein essential for faithful chromosome segregation. PINX1 mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. PINX1 inhibits telomerase activity and may inhibit cell proliferation and

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PINX1

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: EKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PIN2/TERF1-interacting telomerase inhibitor 1

Protein Size: 328

Purification: Affinity Purified
More Information
SKU AVIARP57057_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57057_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54984
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×