PITPNB Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: PITPNB is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes. The protein encoded by this gene is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PITPNB

Key Reference: Morgan,C.P., (2006) Biochem. J. 398 (3), 411-421

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: FFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphatidylinositol transfer protein beta isoform

Protein Size: 271

Purification: Affinity Purified

• SKU: AVIARP54893_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54893_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23760
• Host: Rabbit